Rat Secondary Antibodies
Biolegend Ultra-LEAFTM Purified anti-rat
Ultra-LEAF Purified anti-rat IL-2 [A23106B] Isotype Mouse IgG2a Reactivity Rat Apps Neut Size 100 g
American Research Products Inc AntiHuman CD62L In Vivo Ab
Anti-Human CD62L In Vivo Antibody - Ultra Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles
CPC Scientific H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
ONE-LETTER SEQUENCE: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys23 and 39 bridge)MOLECULAR FORMULA: C213H349N71O65S3MOLECULAR WEIGHT:5040.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123337-89-3], SYNONYMS: BNP-45 (rat), Brain Natriuretic Peptide-45 (rat)RESEARCH AREA: CardiovascularREFERENCES: M. Aburaya et al., BBRC, 163, 226 (1989)
Biolegend Ultra-LEAF™ Purified anti-mouse CD335 (NKp46)
Ultra-LEAF™ Purified anti-mouse CD335 (NKp46) [29A1.4]; Isotype: Rat IgG2a, κ; Reactivity: Mouse; Apps: FC, IHC-F; Size: 1 mg
Biolegend Spark UV™ 387 anti-mouse CD90.2 (Thy1.2) [S20008D]; Isotype: Mouse IgG2b, κ; Reactivity: Mouse; Apps: FC; Size: 100 μg
Spark UV™ 387 anti-mouse CD90.2 (Thy1.2) [S20008D]; Isotype: Mouse IgG2b, κ; Reactivity: Mouse; Apps: FC; Size: 100 μg
ABclonal Technology APC anti-Human CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
ABclonal Technology APC anti-Human CD162/PSGL-1
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P- E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes As such this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins This protein requires two post-translational modifications tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans for its high-affinity binding activity Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response Alternate splicing results in multiple transcript variants
ABclonal Technology CD162/PSGL-1 Rabbit PolymAb
The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes The inactive IL-18 precursor is processed to its active form by caspase-1 and is capable of stimulating interferon gamma production and of regulating both T helper (Th) 1 and Th2 responses This cytokine has been implicated in the injury of different organs and in potentially fatal conditions characterized by a cytokine storm In humans IL-18 gene is located on chromosome 11 Alternatively spliced transcript variants encoding different isoforms have been found for this gene
American Research Products Inc AntiHuman CD166
Anti-Human CD166 (ALCAM) In Vivo Antibody - Low Endotoxin is a in vivo antibody with human reactivity produced in mouse Available in 100 mg size with 7 - 14 business days lead time Ships via gel pack Functional grade preclinical antibodies may be stored sterile as received at 2-8 C for up to one month For longer term storage aseptically aliquot in working volumes without diluting and store at -80 C Avoid Repeated Freeze Thaw Cycles